PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000657441
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 385aa    MW: 42145 Da    PI: 6.9399
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000657441genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY107.94.9e-34216273259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    +Dgy+WrKYGqK vk+s+fprsYYrCtsa+C+vkk+vers +dp++v++tYeg+H+h+
  MDP0000657441 216 EDGYRWRKYGQKAVKNSPFPRSYYRCTSASCNVKKRVERSFDDPSIVVTTYEGQHTHR 273
                    8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381302.5E-10539384IPR017396PWRKY transcription factor, group IIc
Gene3DG3DSA:2.20.25.806.1E-35200275IPR003657WRKY domain
SuperFamilySSF1182902.22E-29207275IPR003657WRKY domain
PROSITE profilePS5081131.41210275IPR003657WRKY domain
SMARTSM007742.1E-40215274IPR003657WRKY domain
PfamPF031068.8E-27216273IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MSAAAPSAMM LCMHVNQLWY LLLGSGNISR AGVLCSQAMN VKKDVVKRED KINSNNMNGG  60
GGGGGLTTSP FAGMFDFCEG EKSSSLGFME LLGVGVGQDC CPTSLFDYLP QTPSTALPSL  120
ASTMGGKDQL STDYSSLNQQ PTTPNSSSIS SESSEAVNEE HTDHKAATDQ EKSNEEEEHH  180
EQQKTKKELK AKKTSQKRPR EPRFAFMTKS EVDHLEDGYR WRKYGQKAVK NSPFPRSYYR  240
CTSASCNVKK RVERSFDDPS IVVTTYEGQH THRSPLLPRP TLPAASAFPA NNFEMPLIPT  300
RTLFTHDYQQ VQPFADNNSS SPSSAPINFG DYYVNGSSLF TNATSTTGFL HPERRFCSPA  360
TGSALLADHG LLQDIVPSHM LKQE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A6e-27205275777Probable WRKY transcription factor 4
2lex_A6e-27205275777Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.68971e-102fruit| leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC7700100.0KC770010.1 Pyrus pyrifolia microsatellite TXY20 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008343174.10.0PREDICTED: probable WRKY transcription factor 23
SwissprotO229002e-64WRK23_ARATH; Probable WRKY transcription factor 23
TrEMBLV9MHQ60.0V9MHQ6_9R
STRINGPOPTR_0002s19390.14e-81(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100234114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47260.11e-55WRKY DNA-binding protein 23